Anti PGBD4 pAb (ATL-HPA059823)

Atlas Antibodies

SKU:
ATL-HPA059823-25
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm & centrosome.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: piggyBac transposable element derived 4
Gene Name: PGBD4
Alternative Gene Name: FLJ32638, FLJ37497
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052516: 22%, ENSRNOG00000030938: 24%
Entrez Gene ID: 161779
Uniprot ID: Q96DM1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLSHLESDGKSSTSSDSGRSMKWSARAMIPRQRYDFTGTPGRKVDVSDITDPLQYFELFFTEELVSKITRETNAQAALLASKPPGPKGFSRMDKWKD
Gene Sequence PLSHLESDGKSSTSSDSGRSMKWSARAMIPRQRYDFTGTPGRKVDVSDITDPLQYFELFFTEELVSKITRETNAQAALLASKPPGPKGFSRMDKWKD
Gene ID - Mouse ENSMUSG00000052516
Gene ID - Rat ENSRNOG00000030938
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PGBD4 pAb (ATL-HPA059823)
Datasheet Anti PGBD4 pAb (ATL-HPA059823) Datasheet (External Link)
Vendor Page Anti PGBD4 pAb (ATL-HPA059823) at Atlas Antibodies

Documents & Links for Anti PGBD4 pAb (ATL-HPA059823)
Datasheet Anti PGBD4 pAb (ATL-HPA059823) Datasheet (External Link)
Vendor Page Anti PGBD4 pAb (ATL-HPA059823)