Anti PGA3 pAb (ATL-HPA046875)
Atlas Antibodies
- SKU:
- ATL-HPA046875-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PGA3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024738: 63%, ENSRNOG00000054671: 61%
Entrez Gene ID: 643834
Uniprot ID: P0DJD8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYI |
Gene Sequence | GTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYI |
Gene ID - Mouse | ENSMUSG00000024738 |
Gene ID - Rat | ENSRNOG00000054671 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PGA3 pAb (ATL-HPA046875) | |
Datasheet | Anti PGA3 pAb (ATL-HPA046875) Datasheet (External Link) |
Vendor Page | Anti PGA3 pAb (ATL-HPA046875) at Atlas Antibodies |
Documents & Links for Anti PGA3 pAb (ATL-HPA046875) | |
Datasheet | Anti PGA3 pAb (ATL-HPA046875) Datasheet (External Link) |
Vendor Page | Anti PGA3 pAb (ATL-HPA046875) |