Anti PFDN6 pAb (ATL-HPA048123 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA048123-25

• 
• 
• 

Protein Description: prefoldin subunit 6
Gene Name: PFDN6
Alternative Gene Name: H2-KE2, HKE2, KE-2, PFD6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024309: 98%, ENSRNOG00000000473: 96%
Entrez Gene ID: 10471
Uniprot ID: O15212
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQAAKAG
• Gene Sequence: ARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQAAKAG
• Gene ID - Mouse: ENSMUSG00000024309
• Gene ID - Rat: ENSRNOG00000000473
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.