Anti PEX19 pAb (ATL-HPA051966)

Atlas Antibodies

SKU:
ATL-HPA051966-100
  • Immunofluorescent staining of human cell line U-2 OS shows localization to peroxisomes.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: peroxisomal biogenesis factor 19
Gene Name: PEX19
Alternative Gene Name: D1S2223E, HK33, PMP1, PMPI, PXF, PXMP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003464: 97%, ENSRNOG00000057116: 97%
Entrez Gene ID: 5824
Uniprot ID: P40855
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQE
Gene Sequence PGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQE
Gene ID - Mouse ENSMUSG00000003464
Gene ID - Rat ENSRNOG00000057116
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PEX19 pAb (ATL-HPA051966)
Datasheet Anti PEX19 pAb (ATL-HPA051966) Datasheet (External Link)
Vendor Page Anti PEX19 pAb (ATL-HPA051966) at Atlas Antibodies

Documents & Links for Anti PEX19 pAb (ATL-HPA051966)
Datasheet Anti PEX19 pAb (ATL-HPA051966) Datasheet (External Link)
Vendor Page Anti PEX19 pAb (ATL-HPA051966)