Anti PEX14 pAb (ATL-HPA049231)

Atlas Antibodies

SKU:
ATL-HPA049231-25
  • Immunohistochemical staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoli fibrillar center & peroxisomes.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: peroxisomal biogenesis factor 14
Gene Name: PEX14
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028975: 93%, ENSRNOG00000013498: 92%
Entrez Gene ID: 5195
Uniprot ID: O75381
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AAVNHHSSSDISPVSNESTSSSPGKEGHSPEGSTVTYHLLGPQEEGEGVVDVKGQVRMEVQGEEEKREDKEDEE
Gene Sequence AAVNHHSSSDISPVSNESTSSSPGKEGHSPEGSTVTYHLLGPQEEGEGVVDVKGQVRMEVQGEEEKREDKEDEE
Gene ID - Mouse ENSMUSG00000028975
Gene ID - Rat ENSRNOG00000013498
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PEX14 pAb (ATL-HPA049231)
Datasheet Anti PEX14 pAb (ATL-HPA049231) Datasheet (External Link)
Vendor Page Anti PEX14 pAb (ATL-HPA049231) at Atlas Antibodies

Documents & Links for Anti PEX14 pAb (ATL-HPA049231)
Datasheet Anti PEX14 pAb (ATL-HPA049231) Datasheet (External Link)
Vendor Page Anti PEX14 pAb (ATL-HPA049231)