Anti PEX14 pAb (ATL-HPA046104)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046104-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PEX14
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028975: 95%, ENSRNOG00000013498: 97%
Entrez Gene ID: 5195
Uniprot ID: O75381
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IQQQQKIQELAHELAAAKATTSTNWILESQNINELKSEINSLKGLLLNRRQFPPSPSAPKIPSWQIPVKSPSPSSP |
Gene Sequence | IQQQQKIQELAHELAAAKATTSTNWILESQNINELKSEINSLKGLLLNRRQFPPSPSAPKIPSWQIPVKSPSPSSP |
Gene ID - Mouse | ENSMUSG00000028975 |
Gene ID - Rat | ENSRNOG00000013498 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PEX14 pAb (ATL-HPA046104) | |
Datasheet | Anti PEX14 pAb (ATL-HPA046104) Datasheet (External Link) |
Vendor Page | Anti PEX14 pAb (ATL-HPA046104) at Atlas Antibodies |
Documents & Links for Anti PEX14 pAb (ATL-HPA046104) | |
Datasheet | Anti PEX14 pAb (ATL-HPA046104) Datasheet (External Link) |
Vendor Page | Anti PEX14 pAb (ATL-HPA046104) |