Anti PERM1 pAb (ATL-HPA031711 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA031711-25

• 

Protein Description: PPARGC1 and ESRR induced regulator, muscle 1
Gene Name: PERM1
Alternative Gene Name: C1orf170, MGC13275, Perm1, RP11-54O7.8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078486: 61%, ENSRNOG00000020244: 62%
Entrez Gene ID: 84808
Uniprot ID: Q5SV97
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ILKHLPRPPPSAVTRVGPGSSFAVTLPEAYEFFFCDTIEENEEAEAAAAGQDPAGVQWPDMCEFFFPDVGAQRSRRRGSPEPLPRADPVPAPIPGDPVPISIPE
• Gene Sequence: ILKHLPRPPPSAVTRVGPGSSFAVTLPEAYEFFFCDTIEENEEAEAAAAGQDPAGVQWPDMCEFFFPDVGAQRSRRRGSPEPLPRADPVPAPIPGDPVPISIPE
• Gene ID - Mouse: ENSMUSG00000078486
• Gene ID - Rat: ENSRNOG00000020244
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PERM1 pAb (ATL-HPA031711 w/enhanced validation) – 5 Found

Cho, Yoshitake; Tachibana, Shizuko; Hazen, Bethany C; Moresco, James J; Yates, John R 3rd; Kok, Bernard; Saez, Enrique; Ross, Robert S; Russell, Aaron P; Kralli, Anastasia. Perm1 regulates CaMKII activation and shapes skeletal muscle responses to endurance exercise training. Molecular Metabolism. 2019;23( 30862473):88-97. 

Oka, Shin-Ichi; Sabry, Amira D; Horiuchi, Amanda K; Cawley, Keiko M; O'Very, Sean A; Zaitsev, Maria A; Shankar, Thirupura S; Byun, Jaemin; Mukai, Risa; Xu, Xiaoyong; Torres, Natalia S; Kumar, Anil; Yazawa, Masayuki; Ling, Jing; Taleb, Iosif; Saijoh, Yukio; Drakos, Stavros G; Sadoshima, Junichi; Warren, Junco S. Perm1 regulates cardiac energetics as a downstream target of the histone methyltransferase Smyd1. Plos One. 15(6):e0234913. 

Müller, Sebastian; Perdikari, Aliki; Dapito, Dianne H; Sun, Wenfei; Wollscheid, Bernd; Balaz, Miroslav; Wolfrum, Christian. ESRRG and PERM1 Govern Mitochondrial Conversion in Brite/Beige Adipocyte Formation. Frontiers In Endocrinology. 11( 32595605):387. 

Bock, Theresa; Türk, Clara; Aravamudhan, Sriram; Keufgens, Lena; Bloch, Wilhelm; Rozsivalova, Dieu Hien; Romanello, Vanina; Nogara, Leonardo; Blaauw, Bert; Trifunovic, Aleksandra; Braun, Thomas; Krüger, Marcus. PERM1 interacts with the MICOS-MIB complex to connect the mitochondria and sarcolemma via ankyrin B. Nature Communications. 2021;12(1):4900. 

Huang, Chun-Yang; Oka, Shin-Ichi; Xu, Xiaoyong; Chen, Chian-Feng; Tung, Chien-Yi; Chang, Ya-Yuan; Mourad, Youssef; Vehra, Omair; Ivessa, Andreas; Yehia, Ghassan; Romanienko, Peter; Hsu, Chiao-Po; Sadoshima, Junichi. PERM1 regulates genes involved in fatty acid metabolism in the heart by interacting with PPARα and PGC-1α. Scientific Reports. 2022;12(1):14576.