Anti PER1 pAb (ATL-HPA067064)

Atlas Antibodies

SKU:
ATL-HPA067064-25
  • Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: period circadian clock 1
Gene Name: PER1
Alternative Gene Name: PER, RIGUI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020893: 96%, ENSRNOG00000007387: 98%
Entrez Gene ID: 5187
Uniprot ID: O15534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEGADGGGDPRPGESFCPGGVPSPGPPQHRPCPGPSLADDTDANSNGSSGNESNGHESRGASQRSSHSSSSGNGKDSALLETTE
Gene Sequence LEGADGGGDPRPGESFCPGGVPSPGPPQHRPCPGPSLADDTDANSNGSSGNESNGHESRGASQRSSHSSSSGNGKDSALLETTE
Gene ID - Mouse ENSMUSG00000020893
Gene ID - Rat ENSRNOG00000007387
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PER1 pAb (ATL-HPA067064)
Datasheet Anti PER1 pAb (ATL-HPA067064) Datasheet (External Link)
Vendor Page Anti PER1 pAb (ATL-HPA067064) at Atlas Antibodies

Documents & Links for Anti PER1 pAb (ATL-HPA067064)
Datasheet Anti PER1 pAb (ATL-HPA067064) Datasheet (External Link)
Vendor Page Anti PER1 pAb (ATL-HPA067064)