Protein Description: period circadian clock 1
Gene Name: PER1
Alternative Gene Name: PER, RIGUI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020893: 96%, ENSRNOG00000007387: 98%
Entrez Gene ID: 5187
Uniprot ID: O15534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PER1
Alternative Gene Name: PER, RIGUI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020893: 96%, ENSRNOG00000007387: 98%
Entrez Gene ID: 5187
Uniprot ID: O15534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LEGADGGGDPRPGESFCPGGVPSPGPPQHRPCPGPSLADDTDANSNGSSGNESNGHESRGASQRSSHSSSSGNGKDSALLETTE |
Documents & Links for Anti PER1 pAb (ATL-HPA067064) | |
Datasheet | Anti PER1 pAb (ATL-HPA067064) Datasheet (External Link) |
Vendor Page | Anti PER1 pAb (ATL-HPA067064) at Atlas |
Documents & Links for Anti PER1 pAb (ATL-HPA067064) | |
Datasheet | Anti PER1 pAb (ATL-HPA067064) Datasheet (External Link) |
Vendor Page | Anti PER1 pAb (ATL-HPA067064) |