Protein Description: pellino E3 ubiquitin protein ligase family member 3
Gene Name: PELI3
Alternative Gene Name: MGC35521
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024901: 97%, ENSRNOG00000019950: 97%
Entrez Gene ID: 246330
Uniprot ID: Q8N2H9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PELI3
Alternative Gene Name: MGC35521
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024901: 97%, ENSRNOG00000019950: 97%
Entrez Gene ID: 246330
Uniprot ID: Q8N2H9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RSRLALSRRSHANGVKPDVMHHISTPLVSKALSNRGQ |
| Documents & Links for Anti PELI3 pAb (ATL-HPA062281) | |
| Datasheet | Anti PELI3 pAb (ATL-HPA062281) Datasheet (External Link) |
| Vendor Page | Anti PELI3 pAb (ATL-HPA062281) at Atlas |
| Documents & Links for Anti PELI3 pAb (ATL-HPA062281) | |
| Datasheet | Anti PELI3 pAb (ATL-HPA062281) Datasheet (External Link) |
| Vendor Page | Anti PELI3 pAb (ATL-HPA062281) |