Anti PEG10 pAb (ATL-HPA051038 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA051038-25
  • Immunohistochemistry analysis in human placenta and prostate tissues using Anti-PEG10 antibody. Corresponding PEG10 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to nucleus & cytosol.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: paternally expressed 10
Gene Name: PEG10
Alternative Gene Name: HB-1, KIAA1051, Mar2, Mart2, MEF3L, RGAG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000092035: 75%, ENSRNOG00000023257: 28%
Entrez Gene ID: 23089
Uniprot ID: Q86TG7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QCIHIERRLARAAAARKPRSPPRALVLPHIASHHQVDPTEPVGGARMRLTQEEKERRRKLNLCLYCGTGGHYADNCPAKASKSS
Gene Sequence QCIHIERRLARAAAARKPRSPPRALVLPHIASHHQVDPTEPVGGARMRLTQEEKERRRKLNLCLYCGTGGHYADNCPAKASKSS
Gene ID - Mouse ENSMUSG00000092035
Gene ID - Rat ENSRNOG00000023257
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PEG10 pAb (ATL-HPA051038 w/enhanced validation)
Datasheet Anti PEG10 pAb (ATL-HPA051038 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PEG10 pAb (ATL-HPA051038 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PEG10 pAb (ATL-HPA051038 w/enhanced validation)
Datasheet Anti PEG10 pAb (ATL-HPA051038 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PEG10 pAb (ATL-HPA051038 w/enhanced validation)