Anti PEF1 pAb (ATL-HPA061608)

Atlas Antibodies

SKU:
ATL-HPA061608-100
  • Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm, cytosol & vesicles.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: penta-EF-hand domain containing 1
Gene Name: PEF1
Alternative Gene Name: PEF1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028779: 69%, ENSRNOG00000013972: 68%
Entrez Gene ID: 553115
Uniprot ID: Q9UBV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPGSYYPGPPNSGGQYGSGLPPGGGYGGPAPGGPYGPPAGGGPYGHPNPGMFPSGTPGGPYGGAA
Gene Sequence PPGSYYPGPPNSGGQYGSGLPPGGGYGGPAPGGPYGPPAGGGPYGHPNPGMFPSGTPGGPYGGAA
Gene ID - Mouse ENSMUSG00000028779
Gene ID - Rat ENSRNOG00000013972
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PEF1 pAb (ATL-HPA061608)
Datasheet Anti PEF1 pAb (ATL-HPA061608) Datasheet (External Link)
Vendor Page Anti PEF1 pAb (ATL-HPA061608) at Atlas Antibodies

Documents & Links for Anti PEF1 pAb (ATL-HPA061608)
Datasheet Anti PEF1 pAb (ATL-HPA061608) Datasheet (External Link)
Vendor Page Anti PEF1 pAb (ATL-HPA061608)