Anti PDZRN3 pAb (ATL-HPA061420)

Atlas Antibodies

SKU: ATL-HPA061420-25

• 

Protein Description: PDZ domain containing ring finger 3
Gene Name: PDZRN3
Alternative Gene Name: KIAA1095, LNX3, SEMACAP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035357: 94%, ENSRNOG00000057556: 95%
Entrez Gene ID: 23024
Uniprot ID: Q9UPQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SEQENNGDDATASSNPLAGQRKLTCSQDTLGSGDLPFSNESFISADCTDADYLGIPVDECERFR
• Gene Sequence: SEQENNGDDATASSNPLAGQRKLTCSQDTLGSGDLPFSNESFISADCTDADYLGIPVDECERFR
• Gene ID - Mouse: ENSMUSG00000035357
• Gene ID - Rat: ENSRNOG00000057556
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.