Anti PDZD8 pAb (ATL-HPA051610)

Atlas Antibodies

SKU:
ATL-HPA051610-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center & plasma membrane.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: PDZ domain containing 8
Gene Name: PDZD8
Alternative Gene Name: bA129M16.2, FLJ34427, PDZK8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074746: 95%, ENSRNOG00000009460: 96%
Entrez Gene ID: 118987
Uniprot ID: Q8NEN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEEHIHIQQWALTEGRLKVTLLECSRLLIFGSYDREANVHCTLELSSSVWEEKQRSSIKTVELIKGNLQSVGLTLRLVQSTDGYAGHVIIETVAPNSPAAIADLQRGDR
Gene Sequence DEEHIHIQQWALTEGRLKVTLLECSRLLIFGSYDREANVHCTLELSSSVWEEKQRSSIKTVELIKGNLQSVGLTLRLVQSTDGYAGHVIIETVAPNSPAAIADLQRGDR
Gene ID - Mouse ENSMUSG00000074746
Gene ID - Rat ENSRNOG00000009460
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PDZD8 pAb (ATL-HPA051610)
Datasheet Anti PDZD8 pAb (ATL-HPA051610) Datasheet (External Link)
Vendor Page Anti PDZD8 pAb (ATL-HPA051610) at Atlas Antibodies

Documents & Links for Anti PDZD8 pAb (ATL-HPA051610)
Datasheet Anti PDZD8 pAb (ATL-HPA051610) Datasheet (External Link)
Vendor Page Anti PDZD8 pAb (ATL-HPA051610)