Protein Description: PDZ domain containing 2
Gene Name: PDZD2
Alternative Gene Name: KIAA0300, PDZK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022197: 88%, ENSRNOG00000013140: 84%
Entrez Gene ID: 23037
Uniprot ID: O15018
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PDZD2
Alternative Gene Name: KIAA0300, PDZK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022197: 88%, ENSRNOG00000013140: 84%
Entrez Gene ID: 23037
Uniprot ID: O15018
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LMVGVDVSGASYLAEQCWNGGFIYLIMLRRFKHKAHSTYNGNSSNSSEPGETPTLELGDRTAKKGKRTRKFGVISRPPANKAPEESKGS |
| Documents & Links for Anti PDZD2 pAb (ATL-HPA064387) | |
| Datasheet | Anti PDZD2 pAb (ATL-HPA064387) Datasheet (External Link) |
| Vendor Page | Anti PDZD2 pAb (ATL-HPA064387) at Atlas |
| Documents & Links for Anti PDZD2 pAb (ATL-HPA064387) | |
| Datasheet | Anti PDZD2 pAb (ATL-HPA064387) Datasheet (External Link) |
| Vendor Page | Anti PDZD2 pAb (ATL-HPA064387) |