Anti PDYN pAb (ATL-HPA053342 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA053342-25
  • Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA053342 antibody. Corresponding PDYN RNA-seq data are presented for the same tissues.
  • Western blot analysis in human testis tissue.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: prodynorphin
Gene Name: PDYN
Alternative Gene Name: ADCA, PENKB, SCA23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027400: 56%, ENSRNOG00000026036: 56%
Entrez Gene ID: 5173
Uniprot ID: P01213
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLCAVKTQDGPKPINPLICSLQCQAALLPSEEWERCQSFLSFFTPSTLGLNDKEDLGSKSVGEGPYSELAKLSGSFLKELEKSKFLPSISTKE
Gene Sequence SLCAVKTQDGPKPINPLICSLQCQAALLPSEEWERCQSFLSFFTPSTLGLNDKEDLGSKSVGEGPYSELAKLSGSFLKELEKSKFLPSISTKE
Gene ID - Mouse ENSMUSG00000027400
Gene ID - Rat ENSRNOG00000026036
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PDYN pAb (ATL-HPA053342 w/enhanced validation)
Datasheet Anti PDYN pAb (ATL-HPA053342 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PDYN pAb (ATL-HPA053342 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PDYN pAb (ATL-HPA053342 w/enhanced validation)
Datasheet Anti PDYN pAb (ATL-HPA053342 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PDYN pAb (ATL-HPA053342 w/enhanced validation)