Anti PDXDC1 pAb (ATL-HPA047369)
Atlas Antibodies
- SKU:
- ATL-HPA047369-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: PDXDC1
Alternative Gene Name: KIAA0251
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022680: 86%, ENSRNOG00000002407: 80%
Entrez Gene ID: 23042
Uniprot ID: Q6P996
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PTLAEMGKNLKEAVKMLEDSQRRTEEENGKKLISRDIPGPLQGSGQDMVSI |
Gene Sequence | PTLAEMGKNLKEAVKMLEDSQRRTEEENGKKLISRDIPGPLQGSGQDMVSI |
Gene ID - Mouse | ENSMUSG00000022680 |
Gene ID - Rat | ENSRNOG00000002407 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PDXDC1 pAb (ATL-HPA047369) | |
Datasheet | Anti PDXDC1 pAb (ATL-HPA047369) Datasheet (External Link) |
Vendor Page | Anti PDXDC1 pAb (ATL-HPA047369) at Atlas Antibodies |
Documents & Links for Anti PDXDC1 pAb (ATL-HPA047369) | |
Datasheet | Anti PDXDC1 pAb (ATL-HPA047369) Datasheet (External Link) |
Vendor Page | Anti PDXDC1 pAb (ATL-HPA047369) |