Anti PDXDC1 pAb (ATL-HPA047369)

Atlas Antibodies

SKU: ATL-HPA047369-100

• 
• 
• 

Protein Description: pyridoxal-dependent decarboxylase domain containing 1
Gene Name: PDXDC1
Alternative Gene Name: KIAA0251
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022680: 86%, ENSRNOG00000002407: 80%
Entrez Gene ID: 23042
Uniprot ID: Q6P996
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTLAEMGKNLKEAVKMLEDSQRRTEEENGKKLISRDIPGPLQGSGQDMVSI
• Gene Sequence: PTLAEMGKNLKEAVKMLEDSQRRTEEENGKKLISRDIPGPLQGSGQDMVSI
• Gene ID - Mouse: ENSMUSG00000022680
• Gene ID - Rat: ENSRNOG00000002407
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.