Anti PDX1 pAb (ATL-HPA059146 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA059146-25

• 
• 

Protein Description: pancreatic and duodenal homeobox 1
Gene Name: PDX1
Alternative Gene Name: IDX-1, IPF1, MODY4, PDX-1, STF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029644: 88%, ENSRNOG00000046458: 84%
Entrez Gene ID: 3651
Uniprot ID: P52945
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKA
• Gene Sequence: DISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKA
• Gene ID - Mouse: ENSMUSG00000029644
• Gene ID - Rat: ENSRNOG00000046458
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.