Protein Description: pyruvate dehydrogenase phosphatase regulatory subunit
Gene Name: PDPR
Alternative Gene Name: PDP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033624: 94%, ENSRNOG00000022593: 90%
Entrez Gene ID: 55066
Uniprot ID: Q8NCN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PDPR
Alternative Gene Name: PDP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033624: 94%, ENSRNOG00000022593: 90%
Entrez Gene ID: 55066
Uniprot ID: Q8NCN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FEKNPKPIFTEGKNQLEIQNLQEDWDHFEPLLSSLLRRMPELETLEIMKLVNCPETFTPDMRCIMGESPAVQGYFVLAGMNSAG |
| Documents & Links for Anti PDPR pAb (ATL-HPA070386) | |
| Datasheet | Anti PDPR pAb (ATL-HPA070386) Datasheet (External Link) |
| Vendor Page | Anti PDPR pAb (ATL-HPA070386) at Atlas |
| Documents & Links for Anti PDPR pAb (ATL-HPA070386) | |
| Datasheet | Anti PDPR pAb (ATL-HPA070386) Datasheet (External Link) |
| Vendor Page | Anti PDPR pAb (ATL-HPA070386) |