Anti PDLIM7 pAb (ATL-HPA048815 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA048815-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus, actin filaments & focal adhesion sites.
  • Western blot analysis using Anti-PDLIM7 antibody HPA048815 (A) shows similar pattern to independent antibody HPA018794 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: PDZ and LIM domain 7 (enigma)
Gene Name: PDLIM7
Alternative Gene Name: ENIGMA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021493: 96%, ENSRNOG00000013653: 98%
Entrez Gene ID: 9260
Uniprot ID: Q9NR12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GKTPVCHQCHKVIRGRYLVALGHAYHPEEFVCSQCGKVLEEGGFFEEKGAIFCPPCYDVRYAPSCAKCKKKITGEIMHALKMTWH
Gene Sequence GKTPVCHQCHKVIRGRYLVALGHAYHPEEFVCSQCGKVLEEGGFFEEKGAIFCPPCYDVRYAPSCAKCKKKITGEIMHALKMTWH
Gene ID - Mouse ENSMUSG00000021493
Gene ID - Rat ENSRNOG00000013653
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti PDLIM7 pAb (ATL-HPA048815 w/enhanced validation)
Datasheet Anti PDLIM7 pAb (ATL-HPA048815 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PDLIM7 pAb (ATL-HPA048815 w/enhanced validation)