Anti PDIA2 pAb (ATL-HPA051692 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA051692-25

• 

Protein Description: protein disulfide isomerase family A, member 2
Gene Name: PDIA2
Alternative Gene Name: PDA2, PDI, PDIP, PDIR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024184: 85%, ENSRNOG00000036689: 37%
Entrez Gene ID: 64714
Uniprot ID: Q13087
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLAGFGEAAPRFRGQVLFVVVDVAADNEHVLQYFGLKAEAAPTLRLVNLETTKKYA
• Gene Sequence: RFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLAGFGEAAPRFRGQVLFVVVDVAADNEHVLQYFGLKAEAAPTLRLVNLETTKKYA
• Gene ID - Mouse: ENSMUSG00000024184
• Gene ID - Rat: ENSRNOG00000036689
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PDIA2 pAb (ATL-HPA051692 w/enhanced validation) – 1 Found

Guantes, Raul; Rastrojo, Alberto; Neves, Ricardo; Lima, Ana; Aguado, Begoña; Iborra, Francisco J. Global variability in gene expression and alternative splicing is modulated by mitochondrial content. Genome Research. 2015;25(5):633-44.