Anti PDHA2 pAb (ATL-HPA047487)

Atlas Antibodies

SKU:
ATL-HPA047487-25
  • Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in subset of cells in seminiferus ducts.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: pyruvate dehydrogenase (lipoamide) alpha 2
Gene Name: PDHA2
Alternative Gene Name: PDHAL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031299: 97%, ENSRNOG00000025383: 97%
Entrez Gene ID: 5161
Uniprot ID: P29803
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVG
Gene Sequence ILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVG
Gene ID - Mouse ENSMUSG00000031299
Gene ID - Rat ENSRNOG00000025383
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PDHA2 pAb (ATL-HPA047487)
Datasheet Anti PDHA2 pAb (ATL-HPA047487) Datasheet (External Link)
Vendor Page Anti PDHA2 pAb (ATL-HPA047487) at Atlas Antibodies

Documents & Links for Anti PDHA2 pAb (ATL-HPA047487)
Datasheet Anti PDHA2 pAb (ATL-HPA047487) Datasheet (External Link)
Vendor Page Anti PDHA2 pAb (ATL-HPA047487)