Anti PDHA2 pAb (ATL-HPA047487)
Atlas Antibodies
- SKU:
- ATL-HPA047487-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PDHA2
Alternative Gene Name: PDHAL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031299: 97%, ENSRNOG00000025383: 97%
Entrez Gene ID: 5161
Uniprot ID: P29803
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVG |
Gene Sequence | ILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVG |
Gene ID - Mouse | ENSMUSG00000031299 |
Gene ID - Rat | ENSRNOG00000025383 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PDHA2 pAb (ATL-HPA047487) | |
Datasheet | Anti PDHA2 pAb (ATL-HPA047487) Datasheet (External Link) |
Vendor Page | Anti PDHA2 pAb (ATL-HPA047487) at Atlas Antibodies |
Documents & Links for Anti PDHA2 pAb (ATL-HPA047487) | |
Datasheet | Anti PDHA2 pAb (ATL-HPA047487) Datasheet (External Link) |
Vendor Page | Anti PDHA2 pAb (ATL-HPA047487) |