Anti PDGFRL pAb (ATL-HPA052801)

Atlas Antibodies

SKU:
ATL-HPA052801-25
  • Immunofluorescent staining of human cell line A549 shows localization to nucleus, nucleoli & the Golgi apparatus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: platelet-derived growth factor receptor-like
Gene Name: PDGFRL
Alternative Gene Name: PRLTS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031595: 93%, ENSRNOG00000010832: 94%
Entrez Gene ID: 5157
Uniprot ID: Q15198
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGFVYLQPHSEHQGVVYCRAEAGGRSQISVKYQLLYVAVPSGPPSTTILASSNKVKSGDDISVLCTVLGEPDVEVEFTWIFPGQKDERPVTIQDTWRLIHRGLGHTTRISQSVITVEDFETIDAGYYICTAQNLQGQTTV
Gene Sequence RGFVYLQPHSEHQGVVYCRAEAGGRSQISVKYQLLYVAVPSGPPSTTILASSNKVKSGDDISVLCTVLGEPDVEVEFTWIFPGQKDERPVTIQDTWRLIHRGLGHTTRISQSVITVEDFETIDAGYYICTAQNLQGQTTV
Gene ID - Mouse ENSMUSG00000031595
Gene ID - Rat ENSRNOG00000010832
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PDGFRL pAb (ATL-HPA052801)
Datasheet Anti PDGFRL pAb (ATL-HPA052801) Datasheet (External Link)
Vendor Page Anti PDGFRL pAb (ATL-HPA052801) at Atlas Antibodies

Documents & Links for Anti PDGFRL pAb (ATL-HPA052801)
Datasheet Anti PDGFRL pAb (ATL-HPA052801) Datasheet (External Link)
Vendor Page Anti PDGFRL pAb (ATL-HPA052801)