Protein Description: peptide deformylase (mitochondrial)
Gene Name: PDF
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078931: 89%, ENSRNOG00000022303: 87%
Entrez Gene ID: 64146
Uniprot ID: Q9HBH1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PDF
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078931: 89%, ENSRNOG00000022303: 87%
Entrez Gene ID: 64146
Uniprot ID: Q9HBH1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMKVND |
Documents & Links for Anti PDF pAb (ATL-HPA063409) | |
Datasheet | Anti PDF pAb (ATL-HPA063409) Datasheet (External Link) |
Vendor Page | Anti PDF pAb (ATL-HPA063409) at Atlas |
Documents & Links for Anti PDF pAb (ATL-HPA063409) | |
Datasheet | Anti PDF pAb (ATL-HPA063409) Datasheet (External Link) |
Vendor Page | Anti PDF pAb (ATL-HPA063409) |