Anti PDF pAb (ATL-HPA063409)

Atlas Antibodies

SKU:
ATL-HPA063409-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in renal tubules.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: peptide deformylase (mitochondrial)
Gene Name: PDF
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078931: 89%, ENSRNOG00000022303: 87%
Entrez Gene ID: 64146
Uniprot ID: Q9HBH1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMKVND
Gene Sequence ESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMKVND
Gene ID - Mouse ENSMUSG00000078931
Gene ID - Rat ENSRNOG00000022303
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PDF pAb (ATL-HPA063409)
Datasheet Anti PDF pAb (ATL-HPA063409) Datasheet (External Link)
Vendor Page Anti PDF pAb (ATL-HPA063409) at Atlas Antibodies

Documents & Links for Anti PDF pAb (ATL-HPA063409)
Datasheet Anti PDF pAb (ATL-HPA063409) Datasheet (External Link)
Vendor Page Anti PDF pAb (ATL-HPA063409)