Anti PDE6B pAb (ATL-HPA059929)

Atlas Antibodies

SKU: ATL-HPA059929-25

• 
• 

Protein Description: phosphodiesterase 6B, cGMP-specific, rod, beta
Gene Name: PDE6B
Alternative Gene Name: CSNB3, CSNBAD2, PDEB, rd1, RP40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029491: 81%, ENSRNOG00000000065: 79%
Entrez Gene ID: 5158
Uniprot ID: P35913
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSLSEEQARSFLDQNPDFARQYFGKKLSPENVAAACEDGCPPDCDSLRDLCQVEEST
• Gene Sequence: MSLSEEQARSFLDQNPDFARQYFGKKLSPENVAAACEDGCPPDCDSLRDLCQVEEST
• Gene ID - Mouse: ENSMUSG00000029491
• Gene ID - Rat: ENSRNOG00000000065
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.