Protein Description: phosphodiesterase 6A
Gene Name: PDE6A
Alternative Gene Name: PDEA, RP43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024575: 87%, ENSRNOG00000017816: 86%
Entrez Gene ID: 5145
Uniprot ID: P16499
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PDE6A
Alternative Gene Name: PDEA, RP43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024575: 87%, ENSRNOG00000017816: 86%
Entrez Gene ID: 5145
Uniprot ID: P16499
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EEVEKFLDSNIGFAKQYYNLHYRAKLISDLLGAKEAAVDFSNYHSPSSMEESEIIFDLLRDFQENLQTEKCIFNVM |
| Documents & Links for Anti PDE6A pAb (ATL-HPA074677 w/enhanced validation) | |
| Datasheet | Anti PDE6A pAb (ATL-HPA074677 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PDE6A pAb (ATL-HPA074677 w/enhanced validation) at Atlas |
| Documents & Links for Anti PDE6A pAb (ATL-HPA074677 w/enhanced validation) | |
| Datasheet | Anti PDE6A pAb (ATL-HPA074677 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PDE6A pAb (ATL-HPA074677 w/enhanced validation) |