Anti PDE4D pAb (ATL-HPA045895)

Atlas Antibodies

SKU:
ATL-HPA045895-25
  • Immunohistochemical staining of human Heart muscle shows strong cytoplasmic positivity in cardiomyocytes.
  • Immunofluorescent staining of human cell line HeLa shows localization to plasma membrane & cytosol.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line A-549
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: phosphodiesterase 4D, cAMP-specific
Gene Name: PDE4D
Alternative Gene Name: DPDE3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021699: 96%, ENSRNOG00000042536: 98%
Entrez Gene ID: 5144
Uniprot ID: Q08499
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQVEEEAVG
Gene Sequence FELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQVEEEAVG
Gene ID - Mouse ENSMUSG00000021699
Gene ID - Rat ENSRNOG00000042536
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PDE4D pAb (ATL-HPA045895)
Datasheet Anti PDE4D pAb (ATL-HPA045895) Datasheet (External Link)
Vendor Page Anti PDE4D pAb (ATL-HPA045895) at Atlas Antibodies

Documents & Links for Anti PDE4D pAb (ATL-HPA045895)
Datasheet Anti PDE4D pAb (ATL-HPA045895) Datasheet (External Link)
Vendor Page Anti PDE4D pAb (ATL-HPA045895)