Protein Description: phosphodiesterase 4A, cAMP-specific
Gene Name: PDE4A
Alternative Gene Name: DPDE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032177: 92%, ENSRNOG00000020828: 94%
Entrez Gene ID: 5141
Uniprot ID: P27815
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PDE4A
Alternative Gene Name: DPDE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032177: 92%, ENSRNOG00000020828: 94%
Entrez Gene ID: 5141
Uniprot ID: P27815
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LRSVRSNFSLLTNVPVPSNKRSPLGGPTPVCKATLSEETCQQLARETLEEL |
Documents & Links for Anti PDE4A pAb (ATL-HPA076091) | |
Datasheet | Anti PDE4A pAb (ATL-HPA076091) Datasheet (External Link) |
Vendor Page | Anti PDE4A pAb (ATL-HPA076091) at Atlas |
Documents & Links for Anti PDE4A pAb (ATL-HPA076091) | |
Datasheet | Anti PDE4A pAb (ATL-HPA076091) Datasheet (External Link) |
Vendor Page | Anti PDE4A pAb (ATL-HPA076091) |