Protein Description: phosphodiesterase 3B, cGMP-inhibited
Gene Name: PDE3B
Alternative Gene Name: HcGIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030671: 66%, ENSRNOG00000011417: 63%
Entrez Gene ID: 5140
Uniprot ID: Q13370
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PDE3B
Alternative Gene Name: HcGIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030671: 66%, ENSRNOG00000011417: 63%
Entrez Gene ID: 5140
Uniprot ID: Q13370
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LSPVNSSNHGPVSTGSLTNRSPIEFPDTADFLNKPSVILQRSLGNAPNTPDFYQQLRNSDSNLCNSCGHQMLKYVSTSESDGTDCCSGKSGEEENIFSKESFKLMETQQEEETEKKDSRKLFQEGDKWLTEEAQSEQQTNIEQEVS |
| Gene ID - Mouse | ENSMUSG00000030671 |
| Gene ID - Rat | ENSMUSG00000030671 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PDE3B pAb (ATL-HPA056111) | |
| Datasheet | Anti PDE3B pAb (ATL-HPA056111) Datasheet (External Link) |
| Vendor Page | Anti PDE3B pAb (ATL-HPA056111) at Atlas |
| Documents & Links for Anti PDE3B pAb (ATL-HPA056111) | |
| Datasheet | Anti PDE3B pAb (ATL-HPA056111) Datasheet (External Link) |
| Vendor Page | Anti PDE3B pAb (ATL-HPA056111) |