Protein Description: phosphodiesterase 3A
Gene Name: PDE3A
Alternative Gene Name: CGI-PDE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041741: 73%, ENSRNOG00000025042: 76%
Entrez Gene ID: 5139
Uniprot ID: Q14432
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PDE3A
Alternative Gene Name: CGI-PDE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041741: 73%, ENSRNOG00000025042: 76%
Entrez Gene ID: 5139
Uniprot ID: Q14432
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EAPAPNEEETCENNESPKKKTFKRRKIYCQITQHLLQNHKMWKKVIEEEQRLAGIENQSLDQTPQSHSSEQIQAIKEEEEEKGKPRGEEIPTQKP |
| Documents & Links for Anti PDE3A pAb (ATL-HPA074258) | |
| Datasheet | Anti PDE3A pAb (ATL-HPA074258) Datasheet (External Link) |
| Vendor Page | Anti PDE3A pAb (ATL-HPA074258) at Atlas |
| Documents & Links for Anti PDE3A pAb (ATL-HPA074258) | |
| Datasheet | Anti PDE3A pAb (ATL-HPA074258) Datasheet (External Link) |
| Vendor Page | Anti PDE3A pAb (ATL-HPA074258) |