Anti PDE1C pAb (ATL-HPA052375)

Atlas Antibodies

SKU:
ATL-HPA052375-25
  • Immunohistochemical staining of human liver shows strong nuclear positivity in hepatocytes.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: phosphodiesterase 1C, calmodulin-dependent 70kDa
Gene Name: PDE1C
Alternative Gene Name: Hcam3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004347: 76%, ENSRNOG00000012337: 78%
Entrez Gene ID: 5137
Uniprot ID: Q14123
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEQQKEMEAKSQAEEGASGKAEKKTSGETKNQVNGTRANKSDNPRGKNSKAEKSSGEQQQNGDFKDGK
Gene Sequence EEQQKEMEAKSQAEEGASGKAEKKTSGETKNQVNGTRANKSDNPRGKNSKAEKSSGEQQQNGDFKDGK
Gene ID - Mouse ENSMUSG00000004347
Gene ID - Rat ENSRNOG00000012337
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PDE1C pAb (ATL-HPA052375)
Datasheet Anti PDE1C pAb (ATL-HPA052375) Datasheet (External Link)
Vendor Page Anti PDE1C pAb (ATL-HPA052375) at Atlas Antibodies

Documents & Links for Anti PDE1C pAb (ATL-HPA052375)
Datasheet Anti PDE1C pAb (ATL-HPA052375) Datasheet (External Link)
Vendor Page Anti PDE1C pAb (ATL-HPA052375)