Anti PDCL2 pAb (ATL-HPA048260 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA048260-25

• 
• 

Protein Description: phosducin-like 2
Gene Name: PDCL2
Alternative Gene Name: GCPHLP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029235: 87%, ENSRNOG00000002169: 87%
Entrez Gene ID: 132954
Uniprot ID: Q8N4E4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPKEESKDEIEEMVLRLQKEAMVKPFEKMTLAQLKEAEDEFDEEDMQAVETYRKKRLQEWKAL
• Gene Sequence: PPKEESKDEIEEMVLRLQKEAMVKPFEKMTLAQLKEAEDEFDEEDMQAVETYRKKRLQEWKAL
• Gene ID - Mouse: ENSMUSG00000029235
• Gene ID - Rat: ENSRNOG00000002169
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PDCL2 pAb (ATL-HPA048260 w/enhanced validation) – 1 Found

Jamin, Soazik P; Hikmet, Feria; Mathieu, Romain; Jégou, Bernard; Lindskog, Cecilia; Chalmel, Frédéric; Primig, Michael. Combined RNA/tissue profiling identifies novel Cancer/testis genes. Molecular Oncology. 2021;15(11):3003-3023.