Anti PDCD7 pAb (ATL-HPA049388)

Atlas Antibodies

SKU: ATL-HPA049388-25

• 
• 

Protein Description: programmed cell death 7
Gene Name: PDCD7
Alternative Gene Name: ES18, HES18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041837: 96%, ENSRNOG00000014340: 94%
Entrez Gene ID: 10081
Uniprot ID: Q8N8D1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RWRVKCVQEVEEKKREQELKAAADGVLSEVRKKQADTKRMVDILRALEKLRKLRKEAAARKGVCPPASADETFTHHLQRL
• Gene Sequence: RWRVKCVQEVEEKKREQELKAAADGVLSEVRKKQADTKRMVDILRALEKLRKLRKEAAARKGVCPPASADETFTHHLQRL
• Gene ID - Mouse: ENSMUSG00000041837
• Gene ID - Rat: ENSRNOG00000014340
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.