Protein Description: programmed cell death 2
Gene Name: PDCD2
Alternative Gene Name: RP8, ZMYND7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014771: 82%, ENSRNOG00000001490: 80%
Entrez Gene ID: 5134
Uniprot ID: Q16342
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PDCD2
Alternative Gene Name: RP8, ZMYND7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014771: 82%, ENSRNOG00000001490: 80%
Entrez Gene ID: 5134
Uniprot ID: Q16342
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PLSFLLQVYAPLPGRPDAFHRCIFLFCCREQPCCAGLRVFRNQLPRKNDFYSYEPPSENPPPETGESVCLQLKSGA |
Documents & Links for Anti PDCD2 pAb (ATL-HPA075534) | |
Datasheet | Anti PDCD2 pAb (ATL-HPA075534) Datasheet (External Link) |
Vendor Page | Anti PDCD2 pAb (ATL-HPA075534) at Atlas |
Documents & Links for Anti PDCD2 pAb (ATL-HPA075534) | |
Datasheet | Anti PDCD2 pAb (ATL-HPA075534) Datasheet (External Link) |
Vendor Page | Anti PDCD2 pAb (ATL-HPA075534) |