Anti PDAP1 pAb (ATL-HPA050294)

Atlas Antibodies

SKU:
ATL-HPA050294-25
  • Immunohistochemical staining of human tonsil shows cytoplasmic positivity mainly in germinal center cells.
  • Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane & cytoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: PDGFA associated protein 1
Gene Name: PDAP1
Alternative Gene Name: HASPP28, PAP, PAP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029623: 98%, ENSRNOG00000000990: 98%
Entrez Gene ID: 11333
Uniprot ID: Q13442
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRRERE
Gene Sequence EKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRRERE
Gene ID - Mouse ENSMUSG00000029623
Gene ID - Rat ENSRNOG00000000990
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PDAP1 pAb (ATL-HPA050294)
Datasheet Anti PDAP1 pAb (ATL-HPA050294) Datasheet (External Link)
Vendor Page Anti PDAP1 pAb (ATL-HPA050294) at Atlas Antibodies

Documents & Links for Anti PDAP1 pAb (ATL-HPA050294)
Datasheet Anti PDAP1 pAb (ATL-HPA050294) Datasheet (External Link)
Vendor Page Anti PDAP1 pAb (ATL-HPA050294)