Anti PDAP1 pAb (ATL-HPA050294)
Atlas Antibodies
- SKU:
- ATL-HPA050294-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PDAP1
Alternative Gene Name: HASPP28, PAP, PAP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029623: 98%, ENSRNOG00000000990: 98%
Entrez Gene ID: 11333
Uniprot ID: Q13442
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRRERE |
Gene Sequence | EKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRRERE |
Gene ID - Mouse | ENSMUSG00000029623 |
Gene ID - Rat | ENSRNOG00000000990 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PDAP1 pAb (ATL-HPA050294) | |
Datasheet | Anti PDAP1 pAb (ATL-HPA050294) Datasheet (External Link) |
Vendor Page | Anti PDAP1 pAb (ATL-HPA050294) at Atlas Antibodies |
Documents & Links for Anti PDAP1 pAb (ATL-HPA050294) | |
Datasheet | Anti PDAP1 pAb (ATL-HPA050294) Datasheet (External Link) |
Vendor Page | Anti PDAP1 pAb (ATL-HPA050294) |