Anti PCSK2 pAb (ATL-HPA049627 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA049627-25

• 
• 

Protein Description: proprotein convertase subtilisin/kexin type 2
Gene Name: PCSK2
Alternative Gene Name: NEC2, PC2, SPC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027419: 96%, ENSRNOG00000005438: 96%
Entrez Gene ID: 5126
Uniprot ID: P16519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FTNHFLVELHKGGEDKARQVAAEHGFGVRKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDINMNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHP
• Gene Sequence: FTNHFLVELHKGGEDKARQVAAEHGFGVRKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDINMNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHP
• Gene ID - Mouse: ENSMUSG00000027419
• Gene ID - Rat: ENSRNOG00000005438
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.