Protein Description: proprotein convertase subtilisin/kexin type 1
Gene Name: PCSK1
Alternative Gene Name: NEC1, PC1, PC3, SPC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021587: 80%, ENSRNOG00000011107: 82%
Entrez Gene ID: 5122
Uniprot ID: P29120
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PCSK1
Alternative Gene Name: NEC1, PC1, PC3, SPC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021587: 80%, ENSRNOG00000011107: 82%
Entrez Gene ID: 5122
Uniprot ID: P29120
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EGRIVNWKLILHGTSSQPEHMKQPRVYTSYNTVQNDRRGVEKMVDPGEEQPTQENPKENTLVSKS |
Documents & Links for Anti PCSK1 pAb (ATL-HPA079656) | |
Datasheet | Anti PCSK1 pAb (ATL-HPA079656) Datasheet (External Link) |
Vendor Page | Anti PCSK1 pAb (ATL-HPA079656) at Atlas |
Documents & Links for Anti PCSK1 pAb (ATL-HPA079656) | |
Datasheet | Anti PCSK1 pAb (ATL-HPA079656) Datasheet (External Link) |
Vendor Page | Anti PCSK1 pAb (ATL-HPA079656) |