Anti PCP4L1 pAb (ATL-HPA052833 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA052833-25

• 
• 

Protein Description: Purkinje cell protein 4 like 1
Gene Name: PCP4L1
Alternative Gene Name: IQM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038370: 85%, ENSRNOG00000003209: 85%
Entrez Gene ID: 654790
Uniprot ID: A6NKN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELNTKTSPATNQAAGQEEKGKAGNVKKAEEEEEIDIDLTAPETEKAALAIQGKFR
• Gene Sequence: ELNTKTSPATNQAAGQEEKGKAGNVKKAEEEEEIDIDLTAPETEKAALAIQGKFR
• Gene ID - Mouse: ENSMUSG00000038370
• Gene ID - Rat: ENSRNOG00000003209
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.