Anti PCP2 pAb (ATL-HPA057428)

Catalog No:
ATL-HPA057428-25
$401.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: Purkinje cell protein 2
Gene Name: PCP2
Alternative Gene Name: GPSM4, MGC41903
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004630: 82%, ENSRNOG00000000993: 85%
Entrez Gene ID: 126006
Uniprot ID: Q8IVA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence DQEGFFNLLSHVQGDRMEGQRCSLQAGPGQTTKSQSDPTPEMDSLMDMLASTQGRRMDDQRVTVSSLPGFQPVGSKDGAQKRAGTLSPQPL

Documents & Links for Anti PCP2 pAb (ATL-HPA057428)
Datasheet Anti PCP2 pAb (ATL-HPA057428) Datasheet (External Link)
Vendor Page Anti PCP2 pAb (ATL-HPA057428) at Atlas

Documents & Links for Anti PCP2 pAb (ATL-HPA057428)
Datasheet Anti PCP2 pAb (ATL-HPA057428) Datasheet (External Link)
Vendor Page Anti PCP2 pAb (ATL-HPA057428)