Anti PCK2 pAb (ATL-HPA051162 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA051162-25
  • Immunohistochemistry analysis in human liver and skeletal muscle tissues using HPA051162 antibody. Corresponding PCK2 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria.
  • Western blot analysis using Anti-PCK2 antibody HPA051162 (A) shows similar pattern to independent antibody HPA053502 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: phosphoenolpyruvate carboxykinase 2 (mitochondrial)
Gene Name: PCK2
Alternative Gene Name: PEPCK, PEPCK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040618: 79%, ENSRNOG00000018536: 80%
Entrez Gene ID: 5106
Uniprot ID: Q16822
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLNWHGLSPLGWPSCRSIQTLRVLSGDLGQLPTGIRDFVEHSARLCQPEGIHICDGTEAENTATLTLLEQQGLIRKLPKYNNCWLARTDPKD
Gene Sequence RLNWHGLSPLGWPSCRSIQTLRVLSGDLGQLPTGIRDFVEHSARLCQPEGIHICDGTEAENTATLTLLEQQGLIRKLPKYNNCWLARTDPKD
Gene ID - Mouse ENSMUSG00000040618
Gene ID - Rat ENSRNOG00000018536
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PCK2 pAb (ATL-HPA051162 w/enhanced validation)
Datasheet Anti PCK2 pAb (ATL-HPA051162 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PCK2 pAb (ATL-HPA051162 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PCK2 pAb (ATL-HPA051162 w/enhanced validation)
Datasheet Anti PCK2 pAb (ATL-HPA051162 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PCK2 pAb (ATL-HPA051162 w/enhanced validation)