Anti PCGF1 pAb (ATL-HPA069156)

Atlas Antibodies

SKU: ATL-HPA069156-25

• 

Protein Description: polycomb group ring finger 1
Gene Name: PCGF1
Alternative Gene Name: MGC10882, NSPC1, RNF68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069678: 100%, ENSRNOG00000051433: 100%
Entrez Gene ID: 84759
Uniprot ID: Q9BSM1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MASPQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDA
• Gene Sequence: MASPQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDA
• Gene ID - Mouse: ENSMUSG00000069678
• Gene ID - Rat: ENSRNOG00000051433
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.