Anti PCED1A pAb (ATL-HPA050816)

Atlas Antibodies

SKU: ATL-HPA050816-25

• 
• 

Protein Description: PC-esterase domain containing 1A
Gene Name: PCED1A
Alternative Gene Name: bA12M19.1, C20orf81, FAM113A, FLJ22376
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037773: 74%, ENSRNOG00000021221: 74%
Entrez Gene ID: 64773
Uniprot ID: Q9H1Q7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPPPIPGPNPHGQHWGPVVHRGMPRYVPNSPYHVRRMGGPCRQRLRHSERLIHTYKLDRRPPAHS
• Gene Sequence: LPPPIPGPNPHGQHWGPVVHRGMPRYVPNSPYHVRRMGGPCRQRLRHSERLIHTYKLDRRPPAHS
• Gene ID - Mouse: ENSMUSG00000037773
• Gene ID - Rat: ENSRNOG00000021221
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.