Anti PCDHGB3 pAb (ATL-HPA035822)

Atlas Antibodies

SKU:
ATL-HPA035822-25
  • Immunofluorescent staining of human cell line BJ shows localization to nucleoplasm, plasma membrane & vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: protocadherin gamma subfamily B, 3
Gene Name: PCDHGB3
Alternative Gene Name: PCDH-GAMMA-B3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102748: 49%, ENSRNOG00000042264: 44%
Entrez Gene ID: 56102
Uniprot ID: Q9Y5G1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLRLRCSSRPATEGYFQPGVCFKTVPGVLPTYSERTLPYSYNPCAASHSSNTEFKFLNIKAENAAPQDLLCDEASWFESNDNPEMPSNSGNLQ
Gene Sequence SLRLRCSSRPATEGYFQPGVCFKTVPGVLPTYSERTLPYSYNPCAASHSSNTEFKFLNIKAENAAPQDLLCDEASWFESNDNPEMPSNSGNLQ
Gene ID - Mouse ENSMUSG00000102748
Gene ID - Rat ENSRNOG00000042264
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PCDHGB3 pAb (ATL-HPA035822)
Datasheet Anti PCDHGB3 pAb (ATL-HPA035822) Datasheet (External Link)
Vendor Page Anti PCDHGB3 pAb (ATL-HPA035822) at Atlas Antibodies

Documents & Links for Anti PCDHGB3 pAb (ATL-HPA035822)
Datasheet Anti PCDHGB3 pAb (ATL-HPA035822) Datasheet (External Link)
Vendor Page Anti PCDHGB3 pAb (ATL-HPA035822)