Anti PCDHB1 pAb (ATL-HPA053921)
Atlas Antibodies
- SKU:
- ATL-HPA053921-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PCDHB1
Alternative Gene Name: PCDH-BETA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051663: 93%, ENSRNOG00000020103: 92%
Entrez Gene ID: 29930
Uniprot ID: Q9Y5F3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IQEHFYDDCNFSNNLVQGQGNGSLSRPCPYEMCSATGTGNSEFRFLKRFMPNFPFPHATGE |
Gene Sequence | IQEHFYDDCNFSNNLVQGQGNGSLSRPCPYEMCSATGTGNSEFRFLKRFMPNFPFPHATGE |
Gene ID - Mouse | ENSMUSG00000051663 |
Gene ID - Rat | ENSRNOG00000020103 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PCDHB1 pAb (ATL-HPA053921) | |
Datasheet | Anti PCDHB1 pAb (ATL-HPA053921) Datasheet (External Link) |
Vendor Page | Anti PCDHB1 pAb (ATL-HPA053921) at Atlas Antibodies |
Documents & Links for Anti PCDHB1 pAb (ATL-HPA053921) | |
Datasheet | Anti PCDHB1 pAb (ATL-HPA053921) Datasheet (External Link) |
Vendor Page | Anti PCDHB1 pAb (ATL-HPA053921) |