Anti PCCA pAb (ATL-HPA047792 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047792-100

• 
• 

Protein Description: propionyl CoA carboxylase, alpha polypeptide
Gene Name: PCCA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041650: 93%, ENSRNOG00000057042: 84%
Entrez Gene ID: 5095
Uniprot ID: P05165
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YPLRHKQADIRINGWAVECRVYAEDPYKSFGLPSIGRLSQYQEPLHLPGVRVDSGIQPGSDISIYYDPMISKLITYGSDRTEALKRMADALDNY
• Gene Sequence: YPLRHKQADIRINGWAVECRVYAEDPYKSFGLPSIGRLSQYQEPLHLPGVRVDSGIQPGSDISIYYDPMISKLITYGSDRTEALKRMADALDNY
• Gene ID - Mouse: ENSMUSG00000041650
• Gene ID - Rat: ENSRNOG00000057042
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.