Anti PCBD1 pAb (ATL-HPA061723)

Atlas Antibodies

SKU:
ATL-HPA061723-100
  • Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha
Gene Name: PCBD1
Alternative Gene Name: DCOH, PCBD, PCD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020098: 100%, ENSRNOG00000000566: 100%
Entrez Gene ID: 5092
Uniprot ID: P61457
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Gene Sequence YNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Gene ID - Mouse ENSMUSG00000020098
Gene ID - Rat ENSRNOG00000000566
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PCBD1 pAb (ATL-HPA061723)
Datasheet Anti PCBD1 pAb (ATL-HPA061723) Datasheet (External Link)
Vendor Page Anti PCBD1 pAb (ATL-HPA061723) at Atlas Antibodies

Documents & Links for Anti PCBD1 pAb (ATL-HPA061723)
Datasheet Anti PCBD1 pAb (ATL-HPA061723) Datasheet (External Link)
Vendor Page Anti PCBD1 pAb (ATL-HPA061723)