Anti PCBD1 pAb (ATL-HPA061723)

Atlas Antibodies

SKU: ATL-HPA061723-100

• 
• 

Protein Description: pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha
Gene Name: PCBD1
Alternative Gene Name: DCOH, PCBD, PCD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020098: 100%, ENSRNOG00000000566: 100%
Entrez Gene ID: 5092
Uniprot ID: P61457
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
• Gene Sequence: YNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
• Gene ID - Mouse: ENSMUSG00000020098
• Gene ID - Rat: ENSRNOG00000000566
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.