Anti PBK pAb (ATL-HPA050656 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA050656-25

• 
• 

Protein Description: PDZ binding kinase
Gene Name: PBK
Alternative Gene Name: CT84, FLJ14385, Nori-3, SPK, TOPK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022033: 84%, ENSRNOG00000015308: 88%
Entrez Gene ID: 55872
Uniprot ID: Q96KB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQD
• Gene Sequence: ISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQD
• Gene ID - Mouse: ENSMUSG00000022033
• Gene ID - Rat: ENSRNOG00000015308
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.