Anti PATL1 pAb (ATL-HPA074680)

Atlas Antibodies

SKU:
ATL-HPA074680-25
  • Immunofluorescent staining of human cell line SiHa shows localization to cytosol & cytoplasmic bodies.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: PAT1 homolog 1, processing body mRNA decay factor
Gene Name: PATL1
Alternative Gene Name: FLJ36874, Pat1b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046139: 98%, ENSRNOG00000021052: 96%
Entrez Gene ID: 219988
Uniprot ID: Q86TB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLEHAYKPVQFEGSLGKLTVSSVNNPRKMIDAVVTSRSEDDETKEKQVRDKRRKTLVIIEKTYSLLLDVEDYERRYLLSLEEERPALMDDRKHKICSMYD
Gene Sequence KLEHAYKPVQFEGSLGKLTVSSVNNPRKMIDAVVTSRSEDDETKEKQVRDKRRKTLVIIEKTYSLLLDVEDYERRYLLSLEEERPALMDDRKHKICSMYD
Gene ID - Mouse ENSMUSG00000046139
Gene ID - Rat ENSRNOG00000021052
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PATL1 pAb (ATL-HPA074680)
Datasheet Anti PATL1 pAb (ATL-HPA074680) Datasheet (External Link)
Vendor Page Anti PATL1 pAb (ATL-HPA074680) at Atlas Antibodies

Documents & Links for Anti PATL1 pAb (ATL-HPA074680)
Datasheet Anti PATL1 pAb (ATL-HPA074680) Datasheet (External Link)
Vendor Page Anti PATL1 pAb (ATL-HPA074680)