Anti PATE4 pAb (ATL-HPA045632)

Atlas Antibodies

SKU:
ATL-HPA045632-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity  in cells in seminiferous ducts.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: prostate and testis expressed 4
Gene Name: PATE4
Alternative Gene Name: FLJ41047, PATE-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032099: 38%, ENSRNOG00000039447: 35%
Entrez Gene ID: 399968
Uniprot ID: P0C8F1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLKCNTCIYTEGWKCMAGRGTCIAKENELCSTTAYFRGDKHMYSTHMCKYKCREEESSKRGLLRVTLCGDRNFCNVF
Gene Sequence GLKCNTCIYTEGWKCMAGRGTCIAKENELCSTTAYFRGDKHMYSTHMCKYKCREEESSKRGLLRVTLCGDRNFCNVF
Gene ID - Mouse ENSMUSG00000032099
Gene ID - Rat ENSRNOG00000039447
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PATE4 pAb (ATL-HPA045632)
Datasheet Anti PATE4 pAb (ATL-HPA045632) Datasheet (External Link)
Vendor Page Anti PATE4 pAb (ATL-HPA045632) at Atlas Antibodies

Documents & Links for Anti PATE4 pAb (ATL-HPA045632)
Datasheet Anti PATE4 pAb (ATL-HPA045632) Datasheet (External Link)
Vendor Page Anti PATE4 pAb (ATL-HPA045632)