Anti PAQR7 pAb (ATL-HPA046936)

Atlas Antibodies

SKU: ATL-HPA046936-25

• 
• 

Protein Description: progestin and adipoQ receptor family member VII
Gene Name: PAQR7
Alternative Gene Name: MPRA, mSR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037348: 78%, ENSRNOG00000022054: 81%
Entrez Gene ID: 164091
Uniprot ID: Q86WK9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAMAQKLSHLLPSLRQVIQEPQLSLQPEPVFTVDRAEVPPLFWKPYIYAGYRPLHQTWRFYFRTLFQQHNEA
• Gene Sequence: MAMAQKLSHLLPSLRQVIQEPQLSLQPEPVFTVDRAEVPPLFWKPYIYAGYRPLHQTWRFYFRTLFQQHNEA
• Gene ID - Mouse: ENSMUSG00000037348
• Gene ID - Rat: ENSRNOG00000022054
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.