Anti PAPSS1 pAb (ATL-HPA049781)

Atlas Antibodies

SKU: ATL-HPA049781-25

• 
• 

Protein Description: 3'-phosphoadenosine 5'-phosphosulfate synthase 1
Gene Name: PAPSS1
Alternative Gene Name: ATPSK1, PAPSS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028032: 98%, ENSRNOG00000011311: 98%
Entrez Gene ID: 9061
Uniprot ID: O43252
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKINKVDMQWVQVLAE
• Gene Sequence: QERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKINKVDMQWVQVLAE
• Gene ID - Mouse: ENSMUSG00000028032
• Gene ID - Rat: ENSRNOG00000011311
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.